McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF266-1:5

Chromosome

chr19

Gene Name

lnc-ZNF266-1

Start

9402858

CPC Label

noncoding

End

9407024

Cancer

OSCC

Strand

-

Peptide

LESIPSAFSGR

Modified Peptide

n[145]LESIPSAFSGR

Peptide Length

11

ORF Length

57

Open Reading Frame (ORF)

MLESIPSAFSGRDCRKLAYFLTFFLKCLVEFTSEHIWTWCFLFWNVIILFLYRYRSI

Conservation Score

0.227

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.0379412

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7328

PhyloCSF Frame 3

0

CNTI Score

-0.395226444