McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF26-12:1

Chromosome

chr12

Gene Name

lnc-ZNF26-12

Start

132908714

CPC Label

noncoding

End

132914294

Cancer

OV

Strand

+

Peptide

EAERTEVSPAAAAGGGAR

Modified Peptide

n[145]EAERTEVSPAAAAGGGAR

Peptide Length

18

ORF Length

86

Open Reading Frame (ORF)

LTEPPRSAGTYYLGAKFQSVVCLPKPTSFQRSPASPHPRLGPSPPRRLSPREAERTEVSPAAAAGGGARLWTRPSGSSEAAAPLLR

Conservation Score

0.023

PhyloCSF Frame 1

0.23

No. of Spectra

1

CPC Coding Probability

0.211575

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.341

PhyloCSF Frame 3

0

CNTI Score

-0.31337596