McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF257-5:1

Chromosome

chr19

Gene Name

lnc-ZNF257-5

Start

21843057

CPC Label

noncoding

End

21843835

Cancer

OSCC

Strand

+

Peptide

QESQIAHILSR

Modified Peptide

n[145]QESQIAHILSR

Peptide Length

11

ORF Length

89

Open Reading Frame (ORF)

LGRAQKGETHYLGAGTSDMSQCPLRQHQGKSIGSHDLHAGSSDMSQSHLCTGPRQESQIAHILSRGMCHNHTCRKTQKSDKTVLHVSSF

Conservation Score

0.694

PhyloCSF Frame 1

0

No. of Spectra

14

CPC Coding Probability

0.0431872

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9953

PhyloCSF Frame 3

0

CNTI Score

-0.408313106