McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF251-2:4

Chromosome

chr8

Gene Name

lnc-ZNF251-2

Start

144698613

CPC Label

noncoding

End

144699185

Cancer

PRAD

Strand

-

Peptide

KSQENMDGTDR

Modified Peptide

‚Äč

Peptide Length

11

ORF Length

51

Open Reading Frame (ORF)

LIPKPTRRCPDPLMAKDTHGKGLRPLSTDCARQARKSQENMDGTDRFLAKY

Conservation Score

0.24

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.0684671

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9563

PhyloCSF Frame 3

0

CNTI Score

-0.345396173