McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF25-9:4

Chromosome

chr10

Gene Name

lnc-ZNF25-9

Start

38640781

CPC Label

coding

End

38689069

Cancer

LUAD

Strand

-

Peptide

AGLGLDPQAWR

Modified Peptide

n[230]AGLGLDPQAWR

Peptide Length

11

ORF Length

177

Open Reading Frame (ORF)

LFVIWYMTWSILGSEALPGGNLFGLLIIFYSAIIGGKNLQLIRIPLVPPFPPLLGMLLAGFTIRNVPFINEHVHVPNAWSSILRSIALNIILIRAGLGLDPQAWRHLKVVCFRLAVGPCLMEASAAAVFSHFIMKFPWQWAILLGFVLGAVSPVVVVLYMMVLQENGYGVEEDIPTY

Conservation Score

1

PhyloCSF Frame 1

7.172

No. of Spectra

1

CPC Coding Probability

0.979724

PhyloCSF Frame 2 

-0.667

CNTI Index

noncoding

Max Probability

0.0623

PhyloCSF Frame 3

-3.179

CNTI Score

-0.366196355