McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF25-5:1

Chromosome

chr10

Gene Name

lnc-ZNF25-5

Start

38447846

CPC Label

noncoding

End

38450545

Cancer

EOGC

Strand

-

Peptide

EAAVGAR

Modified Peptide

n[145]EAAVGAR

Peptide Length

7

ORF Length

80

Open Reading Frame (ORF)

MSWASTGHCEKELGRMRAAGRQAGTWPREAAVGARAGPGEAPGRQEWGLQRLFSNQCWACTGHREAGSRPEELGWRKFGA

Conservation Score

0.005

PhyloCSF Frame 1

0

No. of Spectra

122

CPC Coding Probability

0.0534777

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9976

PhyloCSF Frame 3

0

CNTI Score

-0.248446477