McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF239-1:1

Chromosome

chr10

Gene Name

lnc-ZNF239-1

Start

43579607

CPC Label

noncoding

End

43581819

Cancer

OV

Strand

-

Peptide

SPLSPLLFSIILEVLARAIS

Modified Peptide

n[145]SPLSPLLFSIILEVLARAIS

Peptide Length

20

ORF Length

54

Open Reading Frame (ORF)

LNTEKAVLRGKFLAINTFTKKAERHSLTSGARQRSPLSPLLFSIILEVLARAIS

Conservation Score

0.656

PhyloCSF Frame 1

0

No. of Spectra

16

CPC Coding Probability

0.157194

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6699

PhyloCSF Frame 3

0

CNTI Score

-0.393530331