McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF22-2:5

Chromosome

chr10

Gene Name

lnc-ZNF22-2

Start

45154661

CPC Label

noncoding

End

45186041

Cancer

OSCC

Strand

+

Peptide

SPSVSEVTAMDVEEIGK

Modified Peptide

n[145]SPSVSEVTAM[147]DVEEIGK

Peptide Length

17

ORF Length

41

Open Reading Frame (ORF)

MPTSESGQKEDTKSPSVSEVTAMDVEEIGKASPLKIEAAAA

Conservation Score

0.943

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.234902

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9155

PhyloCSF Frame 3

0

CNTI Score

-0.352364107