McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF217-4:1

Chromosome

chr20

Gene Name

lnc-ZNF217-4

Start

53168642

CPC Label

coding

End

53179550

Cancer

OV

Strand

-

Peptide

LKSPYFNFHMK

Modified Peptide

n[145]LKSPYFNFHM[147]K

Peptide Length

11

ORF Length

63

Open Reading Frame (ORF)

LKSPYFNFHMKLGCNLCVHLICEGSFSTSHSLLPKKALAKSTACFTMDRVLGLRQVQSRGVRG

Conservation Score

0.12

PhyloCSF Frame 1

-3.997

No. of Spectra

4

CPC Coding Probability

0.82664

PhyloCSF Frame 2 

-5.155

CNTI Index

coding

Max Probability

0.7073

PhyloCSF Frame 3

-2.676

CNTI Score

0.590333716