McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF217-3:1

Chromosome

chr20

Gene Name

lnc-ZNF217-3

Start

53196228

CPC Label

noncoding

End

53208705

Cancer

BRCA-Luminal A

Strand

-

Peptide

DTGWASQDAR

Modified Peptide

n[145]DTGWASQDAR

Peptide Length

10

ORF Length

37

Open Reading Frame (ORF)

LGSRDTGWASQDARTLKLQSPSYNSGFLQVRGRAADS

Conservation Score

1

PhyloCSF Frame 1

-2.783

No. of Spectra

2

CPC Coding Probability

0.00499021

PhyloCSF Frame 2 

-4.75

CNTI Index

noncoding

Max Probability

0.9955

PhyloCSF Frame 3

-5.661

CNTI Score

-0.467636847