McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF208-3:1

Chromosome

chr19

Gene Name

lnc-ZNF208-3

Start

22065827

CPC Label

noncoding

End

22066398

Cancer

CCRC

Strand

-

Peptide

VCIFSAEFHK

Modified Peptide

n[230]VCIFSAEFHK

Peptide Length

10

ORF Length

65

Open Reading Frame (ORF)

LKRISKHPECTATLSMRNMSIIKKVCIFSAEFHKVSLSSLLLSHLLAIEWGIYVEIHLTTSTSTF

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0815369

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1484

PhyloCSF Frame 3

0

CNTI Score

-0.384675659