McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF18-2:3

Chromosome

chr17

Gene Name

lnc-ZNF18-2

Start

11874733

CPC Label

noncoding

End

11882139

Cancer

BRCA-Luminal A

Strand

-

Peptide

GSCEGVLMT

Modified Peptide

n[145]GSCEGVLMT

Peptide Length

9

ORF Length

35

Open Reading Frame (ORF)

LVWRMSRNLGLYSHSLSPILMNLEHKGSCEGVLMT

Conservation Score

1

PhyloCSF Frame 1

10.099

No. of Spectra

1

CPC Coding Probability

0.0894668

PhyloCSF Frame 2 

-5.235

CNTI Index

noncoding

Max Probability

0.548

PhyloCSF Frame 3

-4.654

CNTI Score

-0.368419942