McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF131-4:3

Chromosome

chr5

Gene Name

lnc-ZNF131-4

Start

42950008

CPC Label

coding

End

42966059

Cancer

HCC

Strand

+

Peptide

SCILFTK

Modified Peptide

n[230]SCILFTK

Peptide Length

7

ORF Length

94

Open Reading Frame (ORF)

LCVFYRERERELGTRSCILFTKIPNVHLQIVTHKRFSPSRTEFQSLLRSSNLTWGNDKLSINQGPPEQLSLHRPSTNFSFHPLRQTICLWIAFT

Conservation Score

0.024

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.684991

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9971

PhyloCSF Frame 3

0

CNTI Score

0.735998116