McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF131-4:1

Chromosome

chr5

Gene Name

lnc-ZNF131-4

Start

42950860

CPC Label

coding

End

42960547

Cancer

OV

Strand

+

Peptide

VTPAGGVVKDNIRFDAANGAVTK

Modified Peptide

n[145]VTPAGGVVKDNIRFDAANGAVTK

Peptide Length

23

ORF Length

69

Open Reading Frame (ORF)

LRVTPAGGVVKDNIRFDAANGAVTKKPSTLRKKRGSATEKLRTTSAVAEKPPTPRHRQNSQWKPQVLRP

Conservation Score

0.035

PhyloCSF Frame 1

-3.773

No. of Spectra

3

CPC Coding Probability

0.654932

PhyloCSF Frame 2 

-3.034

CNTI Index

noncoding

Max Probability

0.9617

PhyloCSF Frame 3

-4.472

CNTI Score

-0.263159146