McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF131-2:5

Chromosome

chr5

Gene Name

lnc-ZNF131-2

Start

43064987

CPC Label

noncoding

End

43076630

Cancer

OV

Strand

+

Peptide

AQNVPERTTTRDPPNTGTK

Modified Peptide

n[145]AQNVPERTTTRDPPNTGTK

Peptide Length

19

ORF Length

141

Open Reading Frame (ORF)

LDEPGRMSDQRRAQNVPERTTTRDPPNTGTKKAVTREAAVGPNQPWSCRPEQDHRTDRAVNTLTSFGLQRAGLKELLACCNTHSGALGSRASLFGCHHIPLIWMPESTIGVTCNMPGPATSPTQSLLLCWCLELPVEPHTH

Conservation Score

0.919

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.2648

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.0846

PhyloCSF Frame 3

0

CNTI Score

-0.340686575