McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF131-10:1

Chromosome

chr5

Gene Name

lnc-ZNF131-10

Start

43018428

CPC Label

noncoding

End

43024247

Cancer

OV

Strand

+

Peptide

SEGFGVPAGR

Modified Peptide

n[145]SEGFGVPAGR

Peptide Length

10

ORF Length

55

Open Reading Frame (ORF)

LASLAGSRRRHFAKPRSLGCGTASGSVPVFSRCLQRPGRRSEGFGVPAGRGGSRL

Conservation Score

0.205

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0123881

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.2614

PhyloCSF Frame 3

0

CNTI Score

-0.363157453