McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF131-1:5

Chromosome

chr5

Gene Name

lnc-ZNF131-1

Start

43042132

CPC Label

noncoding

End

43045268

Cancer

OV

Strand

+

Peptide

LGETNLVTTDSTGFAGR

Modified Peptide

n[145]LGETNLVTTDSTGFAGR

Peptide Length

17

ORF Length

89

Open Reading Frame (ORF)

LGQQKRRAVPVPRNARLGETNLVTTDSTGFAGRNGRRRGGETAGSLHRLCCGLGMVGGTREIVKPAALGPSDQLPVANVCAVAKDNFWP

Conservation Score

0.033

PhyloCSF Frame 1

-3.198

No. of Spectra

39

CPC Coding Probability

0.423193

PhyloCSF Frame 2 

-3.184

CNTI Index

noncoding

Max Probability

0.8436

PhyloCSF Frame 3

-3.396

CNTI Score

-0.282872703