McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF131-1:10

Chromosome

chr5

Gene Name

lnc-ZNF131-1

Start

43041574

CPC Label

noncoding

End

43063032

Cancer

OV

Strand

+

Peptide

LNTEVNVAVSGDGDTVLQPGRQSK

Modified Peptide

n[145]LNTEVNVAVSGDGDTVLQPGRQSK

Peptide Length

24

ORF Length

53

Open Reading Frame (ORF)

LNTEVNVAVSGDGDTVLQPGRQSKTSPKKKKSLAMALKTNISDFSSTLLALNC

Conservation Score

0.801

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.368099

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.0552

PhyloCSF Frame 3

0

CNTI Score

0.643736402