McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF117-1:1

Chromosome

chr7

Gene Name

lnc-ZNF117-1

Start

64888526

CPC Label

noncoding

End

64890100

Cancer

OV

Strand

-

Peptide

GPRATVPEQTQAAPVSSSPAAFQQR

Modified Peptide

n[145]GPRATVPEQTQAAPVSSSPAAFQQR

Peptide Length

25

ORF Length

233

Open Reading Frame (ORF)

MVLGVQLHSQTASRAFAGRRGPRATVPEQTQAAPVSSSPAAFQQRGDPHPRQPHLTVPLRSEETVEDRVAPGAARNQGDLEETGNLASRGDAAPGKGLPPPASELSSARASPPQRGPDPCLAPGARTVPSAKRLRSRKWPPQCTSRQHGVGSGSVSIRLCGAGCERDSPIPLSSRSRTSHPEDFAEDAAPWSGAENRSRPPRSCWVVEKVEGGQVLSATVKIKIIIIKNEWVS

Conservation Score

0.931

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.225089

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.2405

PhyloCSF Frame 3

0

CNTI Score

-0.273501272