McDonnell Genome Institute

Washington University

Transcript

lnc-ZMYND19-8:1

Chromosome

chr9

Gene Name

lnc-ZMYND19-8

Start

138060353

CPC Label

noncoding

End

138062400

Cancer

EOGC

Strand

-

Peptide

LDHLTQHHLGDAALTLK

Modified Peptide

n[145]LDHLTQHHLGDAALTLK

Peptide Length

17

ORF Length

59

Open Reading Frame (ORF)

LDHLTQHHLGDAALTLKAEIKCRLGDTLHGVGVPYFKMNQRPIDGTGCPISKMYGWRKW

Conservation Score

0.006

PhyloCSF Frame 1

-3.307

No. of Spectra

21

CPC Coding Probability

0.0996264

PhyloCSF Frame 2 

-4.988

CNTI Index

noncoding

Max Probability

0.9832

PhyloCSF Frame 3

-5.235

CNTI Score

-0.321494481