McDonnell Genome Institute

Washington University

Transcript

lnc-ZKSCAN5-1:2

Chromosome

chr7

Gene Name

lnc-ZKSCAN5-1

Start

99500282

CPC Label

noncoding

End

99501516

Cancer

OV

Strand

+

Peptide

LWGWGFIILPR

Modified Peptide

n[145]LWGWGFIILPR

Peptide Length

11

ORF Length

71

Open Reading Frame (ORF)

LWGWGFIILPRLDKVVFFSFFRRTLALSPGCLSLLSSLDYRRAPPCPATFCILVEMGFHHVGQAGLELLTS

Conservation Score

0.146

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0371036

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9884

PhyloCSF Frame 3

0

CNTI Score

-0.350143765