McDonnell Genome Institute

Washington University

Transcript

lnc-ZKSCAN2-7:1

Chromosome

chr16

Gene Name

lnc-ZKSCAN2-7

Start

26062749

CPC Label

noncoding

End

26063097

Cancer

OV

Strand

-

Peptide

VLLPEYAGTK

Modified Peptide

n[145]VLLPEYAGTK

Peptide Length

10

ORF Length

44

Open Reading Frame (ORF)

LVPEYVVKVGDKVLLPEYAGTKVVLGDRNYFLFRDGDILGKYVD

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

90

CPC Coding Probability

0.0303244

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9991

PhyloCSF Frame 3

0

CNTI Score

-0.376407428