McDonnell Genome Institute

Washington University

Transcript

lnc-ZIC4-3:2

Chromosome

chr3

Gene Name

lnc-ZIC4-3

Start

147367466

CPC Label

noncoding

End

147370436

Cancer

EOGC

Strand

-

Peptide

NEDIFNILSGR

Modified Peptide

n[145]NEDIFNILSGR

Peptide Length

11

ORF Length

46

Open Reading Frame (ORF)

LLAGLPRQGEQIKKNEDIFNILSGRFIPLKERSIYFFQSKGCSRRG

Conservation Score

0.362

PhyloCSF Frame 1

-3.542

No. of Spectra

1

CPC Coding Probability

0.0418353

PhyloCSF Frame 2 

-5.395

CNTI Index

noncoding

Max Probability

0.9584

PhyloCSF Frame 3

-5.521

CNTI Score

-0.37758043