McDonnell Genome Institute

Washington University

Transcript

lnc-ZIC3-3:3

Chromosome

chrX

Gene Name

lnc-ZIC3-3

Start

137574045

CPC Label

noncoding

End

137981721

Cancer

OSCC

Strand

+

Peptide

MTEIIASLK

Modified Peptide

n[145]M[147]TEIIASLK

Peptide Length

9

ORF Length

57

Open Reading Frame (ORF)

MEYQRKRTRCQDSKSKIKLLPGRMTEIIASLKTLKDAEIRIICSTQPLCCEKCQHFQ

Conservation Score

0.436

PhyloCSF Frame 1

-5.697

No. of Spectra

5

CPC Coding Probability

0.0418777

PhyloCSF Frame 2 

-5.352

CNTI Index

noncoding

Max Probability

0.9995

PhyloCSF Frame 3

-4.811

CNTI Score

-0.389611997