McDonnell Genome Institute

Washington University

Transcript

lnc-ZGRF1-8:1

Chromosome

chr4

Gene Name

lnc-ZGRF1-8

Start

112788082

CPC Label

coding

End

112788878

Cancer

EOGC

Strand

-

Peptide

VVNPLFEERPK

Modified Peptide

n[145]VVNPLFEERPK

Peptide Length

11

ORF Length

138

Open Reading Frame (ORF)

MLKGKKAKGKKVAPAPAVVKKQEAKKVVNPLFEERPKNFGIGQDIQPKRDLTRFVKWPRYIRLQQQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEKKAVGPGREESCWQRGRPHQETTCPLSRS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.603866

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.694

PhyloCSF Frame 3

0

CNTI Score

0.715890929