McDonnell Genome Institute

Washington University

Transcript

lnc-ZGRF1-2:1

Chromosome

chr4

Gene Name

lnc-ZGRF1-2

Start

112692928

CPC Label

noncoding

End

112706826

Cancer

EOGC

Strand

-

Peptide

KDAEQESQTK

Modified Peptide

n[145]KDAEQESQTK

Peptide Length

10

ORF Length

94

Open Reading Frame (ORF)

MGGSKCFQQSFSRVQRKDAEQESQTKAEIQDMKQELSAVNMMDKFARSARLERKINKMMNKLKTHVKVQTAQSGMLKWVISVAFYKLPGTVIRL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.259232

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7022

PhyloCSF Frame 3

0

CNTI Score

-0.321353586