McDonnell Genome Institute

Washington University

Transcript

lnc-ZGLP1-4:1

Chromosome

chr19

Gene Name

lnc-ZGLP1-4

Start

10279414

CPC Label

noncoding

End

10284635

Cancer

OV

Strand

-

Peptide

GASSTRSGVPAGK

Modified Peptide

n[145]GASSTRSGVPAGK

Peptide Length

13

ORF Length

52

Open Reading Frame (ORF)

LARGAPPSTWQRRVRFLPTGCQEGRGASSTRSGVPAGKQRWGCLVKWTLLPA

Conservation Score

1

PhyloCSF Frame 1

-1.941

No. of Spectra

53

CPC Coding Probability

0.049188

PhyloCSF Frame 2 

9.846

CNTI Index

noncoding

Max Probability

0.9895

PhyloCSF Frame 3

-1.429

CNTI Score

-0.319136203