McDonnell Genome Institute

Washington University

Transcript

lnc-ZFP90-2:1

Chromosome

chr16

Gene Name

lnc-ZFP90-2

Start

68579582

CPC Label

noncoding

End

68580737

Cancer

PRAD

Strand

+

Peptide

KCTFIDK

Modified Peptide

KCTFIDK

Peptide Length

7

ORF Length

40

Open Reading Frame (ORF)

MISFVQNSRKCTFIDKKPISSCLGPGAEGEIGCRGTQENS

Conservation Score

0.628

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0683839

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9945

PhyloCSF Frame 3

0

CNTI Score

-0.399301901