McDonnell Genome Institute

Washington University

Transcript

lnc-ZFP64-8:1

Chromosome

chr20

Gene Name

lnc-ZFP64-8

Start

51940543

CPC Label

noncoding

End

51940833

Cancer

PRAD

Strand

-

Peptide

QENGVNLGGGGACSEPR

Modified Peptide

QENGVNLGGGGACSEPR

Peptide Length

17

ORF Length

42

Open Reading Frame (ORF)

LRQENGVNLGGGGACSEPRSCHCTPAWATEQDSLSKKLKKKI

Conservation Score

0.026

PhyloCSF Frame 1

0

No. of Spectra

33

CPC Coding Probability

0.0188402

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.976

PhyloCSF Frame 3

0

CNTI Score

-0.394182968