McDonnell Genome Institute

Washington University

Transcript

lnc-ZFP42-12:1

Chromosome

chr4

Gene Name

lnc-ZFP42-12

Start

187438984

CPC Label

noncoding

End

187451181

Cancer

OV

Strand

+

Peptide

LQMFVLITNYVVLSQIHFR

Modified Peptide

n[145]LQMFVLITNYVVLSQIHFR

Peptide Length

19

ORF Length

54

Open Reading Frame (ORF)

LQMFVLITNYVVLSQIHFRVFPCYSNKAALINVTNDPHVAKSNSSSLTCLMCNI

Conservation Score

0.057

PhyloCSF Frame 1

-2.682

No. of Spectra

1

CPC Coding Probability

0.0929941

PhyloCSF Frame 2 

-4.572

CNTI Index

noncoding

Max Probability

0.9053

PhyloCSF Frame 3

-4.621

CNTI Score

-0.37662278