McDonnell Genome Institute

Washington University

Transcript

lnc-ZFP36L2-1:3

Chromosome

chr2

Gene Name

lnc-ZFP36L2-1

Start

43173952

CPC Label

noncoding

End

43197513

Cancer

CCRC

Strand

-

Peptide

GEQVEVLK

Modified Peptide

GEQVEVLK

Peptide Length

8

ORF Length

39

Open Reading Frame (ORF)

LGSLSRMGELDCGEQWSREEVRGKGEQVEVLKDVLGVQL

Conservation Score

0.154

PhyloCSF Frame 1

-5.019

No. of Spectra

6

CPC Coding Probability

0.0731031

PhyloCSF Frame 2 

-5.834

CNTI Index

noncoding

Max Probability

0.9982

PhyloCSF Frame 3

-3.456

CNTI Score

-0.329521342