McDonnell Genome Institute

Washington University

Transcript

lnc-ZFP36L1-9:5

Chromosome

chr14

Gene Name

lnc-ZFP36L1-9

Start

68557373

CPC Label

noncoding

End

68565250

Cancer

OV

Strand

-

Peptide

GVYVWGSTQEFSIR

Modified Peptide

n[145]GVYVWGSTQEFSIR

Peptide Length

14

ORF Length

98

Open Reading Frame (ORF)

LAHNEKGVYVWGSTQEFSIRANIIFNCRESACGRYSRLQSTGLPGIGNQLQEEVKKHVPRTAHYRAVVSYGKSGYASEFIQSSPHHLSLFRSHLEKEQ

Conservation Score

1

PhyloCSF Frame 1

-3.948

No. of Spectra

2

CPC Coding Probability

0.171025

PhyloCSF Frame 2 

2.204

CNTI Index

noncoding

Max Probability

0.3546

PhyloCSF Frame 3

-2.657

CNTI Score

-0.297874805