McDonnell Genome Institute

Washington University

Transcript

lnc-ZFP36L1-9:3

Chromosome

chr14

Gene Name

lnc-ZFP36L1-9

Start

68513167

CPC Label

noncoding

End

68565250

Cancer

CCRC

Strand

-

Peptide

TTFPILR

Modified Peptide

‚Äč

Peptide Length

7

ORF Length

66

Open Reading Frame (ORF)

LNNMDLNCLGLLICRFLFFQPNTDRKYSTCRIQNLCVWRTTFPILRGSPPHTPRGIPTNAFSCSGG

Conservation Score

0.834

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.482813

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8691

PhyloCSF Frame 3

0

CNTI Score

-0.325250428