McDonnell Genome Institute

Washington University

Transcript

lnc-ZFP36L1-9:2

Chromosome

chr14

Gene Name

lnc-ZFP36L1-9

Start

68513167

CPC Label

noncoding

End

68565250

Cancer

OV

Strand

-

Peptide

MQNNVLLAQAK

Modified Peptide

n[145]MQNNVLLAQAK

Peptide Length

11

ORF Length

36

Open Reading Frame (ORF)

MQNNVLLAQAKLVGSWRFGVTSDPLPQFLPSPTAQN

Conservation Score

1

PhyloCSF Frame 1

-2.641

No. of Spectra

13

CPC Coding Probability

0.0772311

PhyloCSF Frame 2 

-4.715

CNTI Index

noncoding

Max Probability

0.9111

PhyloCSF Frame 3

-4.428

CNTI Score

-0.325250428