McDonnell Genome Institute

Washington University

Transcript

lnc-ZFP36L1-9:1

Chromosome

chr14

Gene Name

lnc-ZFP36L1-9

Start

68557415

CPC Label

noncoding

End

68565260

Cancer

OSCC

Strand

-

Peptide

TLGLGLLIQNK

Modified Peptide

n[145]TLGLGLLIQNK

Peptide Length

11

ORF Length

82

Open Reading Frame (ORF)

LFVSMWTWTSHFRTLGLGLLIQNKVGKSRAASRAAAFSTGDPRADIGLLPSAHSTCWSPPRGAVLASVCVCGQDDRPFLPLL

Conservation Score

0.783

PhyloCSF Frame 1

0

No. of Spectra

16

CPC Coding Probability

0.0733324

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9135

PhyloCSF Frame 3

-5.185

CNTI Score

-0.350320058