McDonnell Genome Institute

Washington University

Transcript

lnc-ZFP36L1-6:1

Chromosome

chr14

Gene Name

lnc-ZFP36L1-6

Start

68887784

CPC Label

noncoding

End

68888084

Cancer

HCC

Strand

-

Peptide

GKVSSAEGAAK

Modified Peptide

GKVSSAEGAAK

Peptide Length

11

ORF Length

67

Open Reading Frame (ORF)

MPKGKVSSAEGAAKEKPKRRSARLSVKPPAKVEAKPKNAAVKDKSSDKKVQTKGKKGAKGKQAEVAN

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

35

CPC Coding Probability

0.136841

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

1

PhyloCSF Frame 3

0

CNTI Score

-0.360529624