McDonnell Genome Institute

Washington University

Transcript

lnc-ZFP36L1-2:13

Chromosome

chr14

Gene Name

lnc-ZFP36L1-2

Start

68625526

CPC Label

noncoding

End

68628787

Cancer

EOGC

Strand

-

Peptide

AGLCAAGRPGSWEPPAPK

Modified Peptide

n[145]AGLCAAGRPGSWEPPAPK

Peptide Length

18

ORF Length

81

Open Reading Frame (ORF)

LAPQCAVVPRLPSGRGFGAGMGGIFVRYLKQSRENKAGLCAAGRPGSWEPPAPKHCAGPGECACARRPVRSGSVPAFTPAE

Conservation Score

1

PhyloCSF Frame 1

-2.062

No. of Spectra

44

CPC Coding Probability

0.0536424

PhyloCSF Frame 2 

-0.263

CNTI Index

noncoding

Max Probability

0.9992

PhyloCSF Frame 3

-1.012

CNTI Score

-0.34442272