McDonnell Genome Institute

Washington University

Transcript

lnc-ZFHX4-6:4

Chromosome

chr8

Gene Name

lnc-ZFHX4-6

Start

77000154

CPC Label

noncoding

End

77001982

Cancer

EOGC

Strand

+

Peptide

GDWPVGR

Modified Peptide

n[145]GDWPVGR

Peptide Length

7

ORF Length

56

Open Reading Frame (ORF)

LLKALDGQTTANADKPKSRRAEKPKRTPARGDWPVGRKNSVSDWQESHEPRVKKSH

Conservation Score

1

PhyloCSF Frame 1

1.664

No. of Spectra

44

CPC Coding Probability

0.026746

PhyloCSF Frame 2 

-0.251

CNTI Index

noncoding

Max Probability

0.9995

PhyloCSF Frame 3

3.323

CNTI Score

-0.330982722