McDonnell Genome Institute

Washington University

Transcript

lnc-ZFHX4-6:12

Chromosome

chr8

Gene Name

lnc-ZFHX4-6

Start

77000303

CPC Label

noncoding

End

77008673

Cancer

EOGC

Strand

+

Peptide

LFISAGSGR

Modified Peptide

n[145]LFISAGSGR

Peptide Length

9

ORF Length

108

Open Reading Frame (ORF)

LGGQGFLCLRTSRRASGRRRRVAARRLRASGVPCSLSEEDRLRDGLVGREPSGRWLRRAWGSCAALGDLPALGACVHREDRLFISAGSGRQVAGPSVIRPAKRSRETP

Conservation Score

1

PhyloCSF Frame 1

-0.671

No. of Spectra

1

CPC Coding Probability

0.0269536

PhyloCSF Frame 2 

0.528

CNTI Index

noncoding

Max Probability

0.6945

PhyloCSF Frame 3

1.83

CNTI Score

-0.314393098