McDonnell Genome Institute

Washington University

Transcript

lnc-ZFHX4-3:6

Chromosome

chr8

Gene Name

lnc-ZFHX4-3

Start

77378700

CPC Label

noncoding

End

77606704

Cancer

PRAD

Strand

+

Peptide

FLLFKPPQCLEFYGSLMER

Modified Peptide

FLLFKPPQCLEFYGSLM[147]ER

Peptide Length

19

ORF Length

122

Open Reading Frame (ORF)

LCWEEEIRTSRDTKSNHVQRKTSYEDTARRWPSVSQREASEETKSANTIMDFQPPGLCENKFLLFKPPQCLEFYGSLMERLKLTKNCGIFLAKSHWGTDSCQQPLNFEVDPSATGPSDATHV

Conservation Score

0.729

PhyloCSF Frame 1

-5.128

No. of Spectra

1

CPC Coding Probability

0.0753683

PhyloCSF Frame 2 

-4.999

CNTI Index

noncoding

Max Probability

0.5679

PhyloCSF Frame 3

-4.159

CNTI Score

-0.359407139