McDonnell Genome Institute

Washington University

Transcript

lnc-ZFHX3-27:14

Chromosome

chr16

Gene Name

lnc-ZFHX3-27

Start

73943077

CPC Label

noncoding

End

74206165

Cancer

OV

Strand

-

Peptide

MVPIQIK

Modified Peptide

n[145]MVPIQIK

Peptide Length

7

ORF Length

67

Open Reading Frame (ORF)

MVPIQIKDPWVSSSGCAVKFTAGRWERGEILQTFGSQTAPTSRSQMPALRGQEHCLSCSLLLSQSLD

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.0370811

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9824

PhyloCSF Frame 3

0

CNTI Score

-0.354825293