McDonnell Genome Institute

Washington University

Transcript

lnc-ZFAT-9:1

Chromosome

chr8

Gene Name

lnc-ZFAT-9

Start

134978826

CPC Label

noncoding

End

134979279

Cancer

OV

Strand

-

Peptide

GNSTLMFTVDIK

Modified Peptide

n[145]GNSTLM[147]FTVDIK

Peptide Length

12

ORF Length

74

Open Reading Frame (ORF)

LWLSRQPKFSKSTTRGNKPDHYSIIKFPLTMELAMEKIKGNSTLMFTVDIKANKHQIKQAVMKLYDLDWPRSTP

Conservation Score

1

PhyloCSF Frame 1

-4.523

No. of Spectra

1

CPC Coding Probability

0.0456909

PhyloCSF Frame 2 

-4.108

CNTI Index

noncoding

Max Probability

0.5111

PhyloCSF Frame 3

-4.603

CNTI Score

-0.320469628