McDonnell Genome Institute

Washington University

Transcript

lnc-ZFAT-8:1

Chromosome

chr8

Gene Name

lnc-ZFAT-8

Start

134877035

CPC Label

noncoding

End

134901283

Cancer

OSCC

Strand

-

Peptide

SFSCWLILLSIMSSRFIHIAACVR

Modified Peptide

n[145]SFSCWLILLSIMSSRFIHIAACVR

Peptide Length

24

ORF Length

33

Open Reading Frame (ORF)

MSFSCWLILLSIMSSRFIHIAACVRTVFLFKAE

Conservation Score

0.429

PhyloCSF Frame 1

-4.622

No. of Spectra

3

CPC Coding Probability

0.0116094

PhyloCSF Frame 2 

-4.972

CNTI Index

noncoding

Max Probability

0.7543

PhyloCSF Frame 3

-5.297

CNTI Score

-0.403277275