McDonnell Genome Institute

Washington University

Transcript

lnc-ZFAT-10:1

Chromosome

chr8

Gene Name

lnc-ZFAT-10

Start

135625184

CPC Label

noncoding

End

135625981

Cancer

OSCC

Strand

-

Peptide

SFLMQIMMEK

Modified Peptide

n[145]SFLM[147]QIMM[147]EK

Peptide Length

10

ORF Length

85

Open Reading Frame (ORF)

LNSFSVSRSFLMQIMMEKTDPVAARQGQETAVAPSLVAPALNTPKKPLSSSSAAPLRPISTQRTAVAPKAALVWCERPWCAQWAR

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

20

CPC Coding Probability

0.0866597

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9772

PhyloCSF Frame 3

0

CNTI Score

-0.353780996