McDonnell Genome Institute

Washington University

Transcript

lnc-ZFAND4-2:1

Chromosome

chr10

Gene Name

lnc-ZFAND4-2

Start

45706430

CPC Label

noncoding

End

45722439

Cancer

LUAD

Strand

-

Peptide

QTLSLQAQRQEKAK

Modified Peptide

n[230]QTLSLQAQRQEKAK

Peptide Length

14

ORF Length

77

Open Reading Frame (ORF)

LFSSQSASNLKGASLLPGKLPTSVSLFDDEDEEDNLFGGTAAKKQTLSLQAQRQEKAKASKLSKKKASALLFSSDEE

Conservation Score

1

PhyloCSF Frame 1

5.009

No. of Spectra

1

CPC Coding Probability

0.104169

PhyloCSF Frame 2 

3.233

CNTI Index

coding

Max Probability

0.3549

PhyloCSF Frame 3

-5.118

CNTI Score

0.706043967