McDonnell Genome Institute

Washington University

Transcript

lnc-ZEB2-22:1

Chromosome

chr2

Gene Name

lnc-ZEB2-22

Start

144655767

CPC Label

noncoding

End

144659887

Cancer

BRCA-Basal-like

Strand

-

Peptide

LLDITISR

Modified Peptide

n[145]LLDITISR

Peptide Length

8

ORF Length

49

Open Reading Frame (ORF)

LKGPHNIGPRKPSVFRENSKPSRHYGGQFPKRSFSKLLDITISRSIKAQ

Conservation Score

0.937

PhyloCSF Frame 1

-4.113

No. of Spectra

26

CPC Coding Probability

0.0215257

PhyloCSF Frame 2 

-6.52

CNTI Index

noncoding

Max Probability

0.9999

PhyloCSF Frame 3

-4.493

CNTI Score

-0.343933214