McDonnell Genome Institute

Washington University

Transcript

lnc-ZEB1-1:3

Chromosome

chr10

Gene Name

lnc-ZEB1-1

Start

31602669

CPC Label

noncoding

End

31606218

Cancer

OSCC

Strand

+

Peptide

LVFAVGDTK

Modified Peptide

n[145]LVFAVGDTK

Peptide Length

9

ORF Length

180

Open Reading Frame (ORF)

LVFAVGDTKTIQAWPLPFSCQEKLKCVVRNCMWFLGLTALKHPGCIGWPQGTQFGYGQYFHAHCHSLLPQVYVGFPCSQPAGQARVALFLSLTLSLQTPNLQVLETLKESPFPLVETRGRNKQVESQGYSFQPMGLGLQHTKLTSRKAIFLDRFRPGIGWTDHMIQHPNWRSLNNRKRCH

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.416469

PhyloCSF Frame 2 

-4.533

CNTI Index

noncoding

Max Probability

0.6893

PhyloCSF Frame 3

-4.718

CNTI Score

-0.269977773