McDonnell Genome Institute

Washington University

Transcript

lnc-ZDHHC9-2:1

Chromosome

chrX

Gene Name

lnc-ZDHHC9-2

Start

129904490

CPC Label

noncoding

End

129906077

Cancer

PRAD

Strand

-

Peptide

LECNGVISAHCNLHLPGSSDSPASASR

Modified Peptide

LECNGVISAHCNLHLPGSSDSPASASR

Peptide Length

27

ORF Length

100

Open Reading Frame (ORF)

LRQSLAVSFRLECNGVISAHCNLHLPGSSDSPASASRVARITGTRHHARLIFAFLVETGFCHVGQAGLEFLASSDLPASASQSAEITGVSHRARPNIYIY

Conservation Score

0.145

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0226495

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7019

PhyloCSF Frame 3

0

CNTI Score

-0.389723219