McDonnell Genome Institute

Washington University

Transcript

lnc-ZDHHC22-2:2

Chromosome

chr14

Gene Name

lnc-ZDHHC22-2

Start

77095718

CPC Label

noncoding

End

77098003

Cancer

BRCA-Luminal A

Strand

-

Peptide

LLIYCLLLK

Modified Peptide

n[145]LLIYCLLLK

Peptide Length

9

ORF Length

72

Open Reading Frame (ORF)

MPVILGRLRQDNRLNLGGGGCGEPRSCHCTPAWATNLRLTKTNKRKPWLLSMKLLIYCLLLKWNKTICLQIT

Conservation Score

0.595

PhyloCSF Frame 1

0

No. of Spectra

18

CPC Coding Probability

0.0759354

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9975

PhyloCSF Frame 3

0

CNTI Score

-0.390228715