McDonnell Genome Institute

Washington University

Transcript

lnc-ZDHHC2-1:1

Chromosome

chr8

Gene Name

lnc-ZDHHC2-1

Start

17131180

CPC Label

noncoding

End

17149789

Cancer

CCRC

Strand

+

Peptide

GACLEPEPMWVSTDHGAR

Modified Peptide

n[230]GACLEPEPMWVSTDHGAR

Peptide Length

18

ORF Length

53

Open Reading Frame (ORF)

MEADKSQDLQGEVASWRLRGACLEPEPMWVSTDHGARHVDFTSTHICCTENPT

Conservation Score

0.963

PhyloCSF Frame 1

-4.225

No. of Spectra

7

CPC Coding Probability

0.0730972

PhyloCSF Frame 2 

-5.049

CNTI Index

noncoding

Max Probability

0.9982

PhyloCSF Frame 3

-5.203

CNTI Score

-0.352979912